PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015879133.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family MYB
Protein Properties Length: 339aa    MW: 38177.4 Da    PI: 6.3434
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015879133.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT++Ed +++ +v+++G g+W++++++ g++R++k+c++rw +yl
   XP_015879133.1 14 RGLWTPQEDAKILAYVAKYGIGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding49.97.4e-1669110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+ E+el++++++  G++ W++Ia++++ gRt++++k++w++
   XP_015879133.1  69 SFTPHEEELIINLHQAIGSR-WSLIAKRLP-GRTDNDVKNYWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.043965IPR017930Myb domain
SuperFamilySSF466893.27E-3111108IPR009057Homeodomain-like
SMARTSM007171.2E-141363IPR001005SANT/Myb domain
PfamPF002491.5E-151461IPR001005SANT/Myb domain
CDDcd001673.76E-121761No hitNo description
Gene3DG3DSA:1.10.10.608.9E-2565116IPR009057Homeodomain-like
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129417.85366116IPR017930Myb domain
PfamPF002496.2E-1469110IPR001005SANT/Myb domain
CDDcd001671.47E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTPQ EDAKILAYVA KYGIGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDSF TPHEEELIIN LHQAIGSRWS LIAKRLPGRT DNDVKNYWNT KLRKKLSKMG  120
IDPVTHKPYS QIFSDLNHTF GPESPTSGIT GLPYTNMILS PTIEQVQDNS FSMNPSSLDF  180
LGQFQVTDQD TLQTYFSNEV TSSCSSSSSS HVTELTSPQS YSCQQSQTQI FTPSSSLSLW  240
SELFLVHEPF QSTEPRQEHE NHPTVLLQSE TAQQCKFANG NEYKHGSQAC DFGYTTGEQR  300
NNGTEASSSS VNSFVDTILD QDREIRAAFP DLFDGSFDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879133.10.0PREDICTED: transcription factor MYB35
TrEMBLM5XBU21e-136M5XBU2_PRUPE; Uncharacterized protein
STRINGVIT_14s0066g02180.t011e-124(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-77MYB family protein